SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000012704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000012704
Domain Number 1 Region: 224-260
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000201
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000017
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 145-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000759
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000012704
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00144
Family CCCH zinc finger 0.0062
Further Details:      
 
Domain Number - Region: 119-143
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00455
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 91-119
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0235
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000012704
Sequence length 269
Comment (Anolis carolinensis)
Sequence
MQELIANVEHIKFELEIAVEQQLGAQPLPFPGMDKSGAAVCDFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKYGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPACKFMHPRFELPMGTTEQPP
LPPPTQPQQKPNNNPPLQRSSSLIQLTSLNSSPNQQRTPQVIGVMQSQSNSIGNRGPRPL
EQVTCYKCGEKGHYANRCTKGHLAFLSGQ
Download sequence
Identical sequences 28377.ENSACAP00000012704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]