SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000012939 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000012939
Domain Number 1 Region: 129-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000337
Family Retrovirus zinc finger-like domains 0.001
Further Details:      
 
Domain Number 2 Region: 86-128
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000361
Family Retrovirus zinc finger-like domains 0.00097
Further Details:      
 
Domain Number 3 Region: 45-85
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000045
Family Retrovirus zinc finger-like domains 0.0011
Further Details:      
 
Domain Number 4 Region: 2-27
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000968
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000012939
Sequence length 171
Comment (Anolis carolinensis)
Sequence
MSSNECFKCGRTGHWARECPTGMGRGRGMRSRGRGFQFMSSSLPDICYRCGESGHLAKDC
DLQEDEACYNCGRGGHIAKDCKEPRREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFG
HIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
Download sequence
Identical sequences XP_008103433.1.98722 28377.ENSACAP00000012939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]