SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000016164 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000016164
Domain Number 1 Region: 125-244
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.23e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000366
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000016164
Domain Number - Region: 264-286
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000244
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000016164
Sequence length 620
Comment (Anolis carolinensis)
Sequence
DYPNKKRKRSRWNQDTMDQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDL
GIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYK
PPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGR
KDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARL
NGTLREDDNRILRPWQNTETRSITNTTVCTKCGGAGHIASDCKFARPGDPQSAQDKARMD
KEYLSLMAELGEAPVPASVGSSSGPSNPPLQSGPRPSGPGNSQPPPVNKDSSRNRPPWMN
SGPSENRPFHGMHGGGGGGPAGPSGPHNFPHPMSNMGGHGGHPMQHNPNGPPPWMQPHNP
PMNQGPHPHGPPGPHHMDQYLGNAPVGSGVYRLQGKGMMPPPMGMMPPPPPPPGGQPPPP
PSGPLPPWQQQQQPPPPPPSSSTPLPWQQNTTSTTTSAGTGAIPPWQQQQAAVAASTGAP
QMPGSPSMVPLPPGVQPPLPPGAPPPPPPPPPGSGGMMYAPPPPPPPMDPTNFVTMMGVG
VPTLPPFGMPPAPPPPPPQN
Download sequence
Identical sequences 28377.ENSACAP00000016164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]