SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000017489 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000017489
Domain Number 1 Region: 57-102
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000269
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 
Weak hits

Sequence:  28377.ENSACAP00000017489
Domain Number - Region: 2-35
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0543
Family Cold shock DNA-binding domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000017489
Sequence length 133
Comment (Anolis carolinensis)
Sequence
QSKLHMEGFRSLKEGEAVEFTFKKSSKGLESIRVTGPGGVFCIGSERRPKGKNLQKRRSK
GDRCYNCGGLDHHAKECKLPPQPKKCHFCQSIAHMVANCPAKTQQSPSSQGKPGYFREEE
DLHRSPLLPETRE
Download sequence
Identical sequences H9GPM8
ENSACAP00000017489 ENSACAP00000017489 28377.ENSACAP00000017489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]