SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI1241B from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI1241B
Domain Number 1 Region: 383-409
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000136
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI1241B
Sequence length 495
Comment (Phaeodactylum tricornutum)
Sequence
MAEANPDIAGLTALVQQLLAERELDRRERDQVALELERARQAAGPVPSVIQPTLPKIGGI
SNGVVWVGGEPNVSWTETKNLEPRSAYCRRHTTDKDLKVLEYMLKPHVPKFKRDDPLFPL
VSFASDVETHMELTGMDSVFWFADPTDSTQMLNVFTSHSRFPENYVAQEVSRKVKNGIYD
KYDIQNLEFSANYLRESLDVTLRGDIRGLLRAKITGPELFMTVVSEIQSSSVRSYRAKER
QLESMSLKTYPGENVKTLTRDIANICDELDRAGRLPEDIILTIVNIYAKSSVEEFRIYFI
GRRVEVERFLKKSSGKSQDVVRAMDDYIGYKEMGLEANSQYQSLIDSGNYGPAATANDTG
DAPHAYMTKTETDALIQQKLKPSTRDTSTIKCFKCGKMGHFANKCPDNAGPSGVPAPTGA
PNWKKVAPAATDEQTKTVEEVKYYWCDHPNCKRWNPSHLTDSHGRRDTDGNLLQEEANAA
VDVATETPSGNLGAW
Download sequence
Identical sequences B7S3U4
XP_002176234.1.39622 jgi|Phatr2_bd|1241|fgenesh1_pg.C_bd_21x34000002 2850.JGI1241B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]