SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI1453 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI1453
Domain Number 1 Region: 907-1078
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000948
Family Retroviral integrase, catalytic domain 0.024
Further Details:      
 
Domain Number 2 Region: 356-387
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000089
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI1453
Sequence length 1316
Comment (Phaeodactylum tricornutum)
Sequence
METEATAGGEVFKGTFAVMSGTVAPKHGGLVDSHAWTGGEPSPDWSKVLIDEPMTPYCYH
AQGFEKGLKIYTSRTGQGEKSAKLFGCSSKDYSLLAFATDAQEHMETHGMDTVFYMKDPS
TSEMKNLFDFHSRFTISQTEAWIDLASKDGTFDKYDKKNLKDSCTWLMNHLDSDLTASIR
PFVRGGTLTGPTVWMRIVGEVQSDSIRRLKKVQEKLETLKLASFKGENVREFAQSFLDLC
IELENAKRLPEDVLLTVVEALSKCTVEEFRIDFMSKRSAVERFMRETAGKDSATIARMSD
RLTYRDLLDEAKSKYTSLLDSGLWGPAGGSGDKSGAPAGFLTKAEVNVLIQKAVSSAKSG
DKSGITCYNCKEVGHYSRDCKNKPADGNGNSSKPKKSKASWRTVAPKSGESETKTENKLE
WHWCAHCKEWRVGHGTATHDHNFKPKEASNGKKGPQANLAATGELLGGGTLSMSAGAGFG
LWTIYTHPLSFTGWQQRNGESWCKASRRKKFSRSYVPFVRLGAYPTRFVLLSSVMLPMSV
VSMVLGGRAESFGSHIVARWYSAWYGGERGEQRAVRVRVRRRRPNLNYHGTWKIRPPPTP
FFATEVPVIPKFSWGAAFAAEGEERLCREQTSASEVDEQYAQPMAFLGSALDSTYWFSRG
SRDELLQTFAVIWDTGATLTVTPHRDDFVEFESYDNGGRHVLKGLAKGLTIGGAGVVAWS
VVADNGDVLTIRTPAYLVPEAGQRLLSPQSFLQSLVSQDLSGSRPSISIGPKALTVEMGA
QSKLTVPYDEGNNLPTSQMFSVESSEESTVELNMCVTDEANQNLSASQKELLRWHYRFGH
RNFQAVQTVLKSGVLGRTPLIMGASKCEHPKCASCQYGKGRRRATGASSTKSVPAKEGAL
KSSDLFPGQRVSMDHFKVTHKGRLYESKGKSLADTMYSGGLIFVDHASSYVHVELCVNFT
AGETLRAKASFERAMLDHGITVQSYQTDNGVFAAKEFMLEIHNMQQSIGFSGVGAHHQNG
VAERSIGTIMAMARTLMLHAAIRWPDVSDACYWPMAVDYAVYQYNHGPKLVTTAAPIDLL
LKTMVPRHRLHDLHVWGCPAYVLDPKLQDGQKIPKWSPRSRRGVFLGLSRKHSSTVPLIL
NCETLTISPQFHVVFDNWFSSVLSMSAEEPFDPNVWTEMFVGSRYEYFFDADDPVELDAE
WLSEREKEVRNIRDREDRVRPQLDLRDGVPKGPKVGTHTTNLSFKRENRATDMPLQLPPT
TPIAVLPTTGTEEDQFPISDPSVPESPSSNKPPSILSPSKICRETPRSPPPPEPEP
Download sequence
Identical sequences B7S4D2
XP_002176375.1.39622 2850.JGI1453 jgi|Phatr2_bd|1453|fgenesh1_pg.C_bd_32x35000096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]