SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI15329 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI15329
Domain Number 1 Region: 250-506
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000432
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 7-131
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000033
Family Voltage-gated potassium channels 0.013
Further Details:      
 
Domain Number 3 Region: 121-209
Classification Level Classification E-value
Superfamily EF-hand 0.000000000794
Family Parvalbumin 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI15329
Sequence length 533
Comment (Phaeodactylum tricornutum)
Sequence
MHHPYVRLAILLSLSPAAQRDIGVLVKMLPEVMNILLILGVFMVFYAWFGTVMFVGTEEG
SMHFSSLIESMWTLWICVTTANYPDVMMPEYNQNRWVTLYFISFMILSFFFLMNLVLAAV
FNEYQLAFQTRKQDRTKASDENLRKAYALMDSEGMGRIDQETVMALFCILNEDFPEFRTL
SDEDTKLLFAILDKDGSSTITEEEFMDFGSVLLLEFVKTSAYSTFVELRLPKIFHSSLYQ
TFCTVVKSNLFEYSIDAILVMNAVVIGIQSYPELSGQAVQIDPKYWDGSIDTIWEGVESV
FTVIYALEVVVKVLVLGWRAYTESYKNVFDFTITILAVISSSIVYYPNEFSDSRLIRMIV
MARVLRLIRLLTAMKRFQLIGIISVEILPAASSALMVLFCIMYFFSALGMHLYGGLITRD
PANSLAYLLLGTDFSENDYWANNFNDMISGMNVLFNMLVVNNWTECEVGFEATTQEKWVR
FFFLSFHVCGVILVNNLVIAFIINAFFEELAIYRERTDEEIVGDGEAVIRNRR
Download sequence
Identical sequences B7G8I5
XP_002183351.1.39622 2850.JGI15329 jgi|Phatr2|15329|e_gw1.19.15.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]