SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI16155 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI16155
Domain Number 1 Region: 49-98
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000144
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 
Domain Number 2 Region: 105-153
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000262
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI16155
Sequence length 153
Comment (Phaeodactylum tricornutum)
Sequence
MANHKKRISGKSEGIGKPKMTKDERRAKYTQIARDRKAKQVAREKSIKLVCYNCRKLGHA
VSECPEQKSQQKMQQSDVKICYKCGSHDHALAACPSMRAGGKKHDGTLPFATCFICHLTG
HLASKCSQNEKGIYVNGGACKTCGSKQHRATDC
Download sequence
Identical sequences B7GB06
jgi|Phatr2|16155|e_gw1.23.105.1 2850.JGI16155 XP_002184286.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]