SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI37492 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2850.JGI37492
Domain Number - Region: 170-187
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0481
Family Retrovirus zinc finger-like domains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI37492
Sequence length 189
Comment (Phaeodactylum tricornutum)
Sequence
MSPNETNRTAKRRLDFADGPDASAAPKRKLRSSSPSPVSSNTDPSQTQLRFSPRTQKARP
TATPTRRTPSRSVVTPDAPKPRPVAVEYVPRYLHQTLDYQRRGQKKDLPTHTRTALALIE
QYYEIPANLEQSRKYGPLSGTTYEELVLQAYTLGTLAVKKEDGAIVSEVDICTECAVLGH
RRGECPTLL
Download sequence
Identical sequences B7G3Y6
2850.JGI37492 XP_002181689.1.39622 jgi|Phatr2|37492|fgenesh1_pg.C_chr_13000102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]