SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI38548 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI38548
Domain Number 1 Region: 100-223
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000429
Family UbiE/COQ5-like 0.044
Further Details:      
 
Weak hits

Sequence:  2850.JGI38548
Domain Number - Region: 340-365
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00139
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI38548
Sequence length 375
Comment (Phaeodactylum tricornutum)
Sequence
MQDLLEEAEGTFATESTVKELRCPFVLELWDEARAVRWDYADGERVYYRPKQRSGVVRKR
RRPVEDFNVDHSLYKPDSWSILVDGRVKPKSLTDCSKLLPLTASFGSLLVRVVPDTASFR
HWAVAWSGPTDRVLEIGCSTGQTSRAFWKARVSSWVGMDTSSDMVQRTRIALQQQDTATG
SARANYRVCHCDALLHPNQAELEARQFGPPTLVFVDIGGNRNLSGVVLMLDWVLTRSVGV
EKRSSGERQPTRLVLVKSQALARALSLFHTDNNRTLPESPNENLASQEFCRRWFEDQLRQ
AQTATLPRHPLQASLVYSPISATQPICRYHNYSTCQKVETCPLDHRHCHLCQRPGHIALR
CPVLRADIVKPFLQK
Download sequence
Identical sequences B7G665
XP_002182521.1.39622 2850.JGI38548 jgi|Phatr2|38548|fgenesh1_pg.C_chr_16000145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]