SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI39341 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI39341
Domain Number 1 Region: 811-950
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000247
Family Retroviral integrase, catalytic domain 0.027
Further Details:      
 
Domain Number 2 Region: 365-386
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000192
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI39341
Sequence length 1167
Comment (Phaeodactylum tricornutum)
Sequence
MSGNPPKAMMAESIYLPPKPTLGGLTCQSAREMVAYTGGKPNATWTNLAEPTKWETPNVI
CPNGVSDKCKNWNFLTQAPTKLFSKSDTSYLQTTWIADQVKHFREGGLNSVMYRPSIADP
TDMVNVMEHHEQVTLTHVLEVEEDVCSKWDAYSCYNNKASSNRILNSISAELSEELRLRM
LPTDTAAVLWMRVMKLVVDGSIEHYNRQKDALCALSPLSEPGQNVHTYSGKVRLICNELW
HARQWEWPLMLVIVRQLCLVTVKAFQSMFLPIKMAMDRTLTEISYLDRTLATAVMVKKGY
HYTQFLTLVEDTYKSLLDNKDWPPASNQKETQGAPTAFLAGMLEVQLNALVQLHVNKTLN
AEKKVFKCFKCGQTGHFSRDCKQPASEGDKTPSDSKKPKAKETGWRVEAPAAGATQTKVV
NSKTYHWCATCNNKDGRWNLTHVMASHTTGAGRRGKFDSPAPLGLMAEGRGDPDLSFRLP
PSIALSSLTAYALLTLFDEPIPPGEQQCLSVTALCRSPAVAGVAVYAGTSVDAKPDSFPV
IWDTGASLSISHEAGDFVSEVRPPPTPLVLKGLAKGLNIVGVGTVEWLVLSQDGMPCLLC
LDAYLVPLAGQRLLCPQSYIQQQQHLLPSDPGKFVVDCDGMSLVGAGDNTVRVPFQTSNN
LPLCMAWLPSGSPSLVAELNLCVTNAQNQNLSLAQKELLCWHYRLGHLHFESICRLHRTG
ALSQSAKVRALHRLAANCDLPKCASCQFGKAKRCPSPGKAQTIVPAHDGSIKKEHLSPGQ
QVSVDHFICSAKGRLSSSKGKTTDDRMFSGGCLFVDHASSLVHVEHQVSLTSHETLQAKH
RFETMTRDRGVTPQSYLSDNSTAFTNAEFTVELRIFRQVQRFAGVGAHHHNGVAERNIQT
IMAMARTMMLHAAICWPEVADPSLWPMAVDYAIYLHNHLPTVSAGLAPIDVFTGMLDPTL
QDRKKLPRWKPCSRRAVFVGFSPKHSTTIPLVVNLVLGAISPQFHCVFDDWFLTVFSDPD
RIPDFEQSPWTNLFSKSRFQYPFDADDGSPPPLEEQWHDEFAERTASAACELIVRDAQDE
ALSGANAAPPLEPVPSGPSLAGVPTSQPPEPLSAPLPTVPRVRFSPDVVAPLAQREPDPA
PLAVPLSFYSGKAEQMLCQSGMAPGPD
Download sequence
Identical sequences B7G8D6
2850.JGI39341 XP_002183327.1.39622 jgi|Phatr2|39341|fgenesh1_pg.C_chr_19000098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]