SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI41515 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI41515
Domain Number 1 Region: 142-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.03e-114
Family Enolase 0.0000000217
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.3e-55
Family Enolase N-terminal domain-like 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI41515
Sequence length 437
Comment (Phaeodactylum tricornutum)
Sequence
MSGITGVLAREILDSRGNPTVEVEVTTADGVFRASVPSGASTGAYEAVELRDGGDRYMGK
GVLQAVQNVNDILGPAVMGMDPVGQGSVDDVMLELDGTPNKANLGANAILGVSLAVAKAG
AAAKKVPLYRHFADLAGNNLDTYTMPVPCFNVINGGSHAGNKLAFQEYFVIPTGAKSFAE
AMQIGCEVYHTLGKIIKAKFGGDATLIGDEGGFAPPCDNREGCELIMEAISKAGYDGKCK
IGLDVAASEFKVKGKDEYDLDFKYDGDIVSGEELGNLYQSLAADFPIVTIEDPFDEDDWE
NWSKFTTKNGATFQVVGDDLTVTNIEKIERAIDEKACTCLLLKVNQIGSISESIAAVTKA
KKAGWGVMTSHRSGETEDTYIADLAVGLCTGQIKTGAPCRSERLAKYNQLLRIEAELEAG
KVTFPGENFRTTAWMGQ
Download sequence
Identical sequences jgi|Phatr2|41515|fgenesh1_pg.C_chr_31000019 2850.JGI41515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]