SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI44395 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI44395
Domain Number 1 Region: 229-309
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.7e-18
Family Canonical RBD 0.0064
Further Details:      
 
Weak hits

Sequence:  2850.JGI44395
Domain Number - Region: 195-224
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00733
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI44395
Sequence length 313
Comment (Phaeodactylum tricornutum)
Sequence
MTEELKSKRKREKKDKKKGKLQAEKEEKESEVVTPPQPNDEEEPINPDQREAGEHESSKA
SKRRKTNGKESREERQKKRKECMDQVPKVDEHGIAYTKLQLRRMSKRVARGLDPIESEQE
VRERLRREAELKREEAAELAGMDYNEGGDNANDPGESDTQERVEEEDGDDGRENQVDKET
SPPVVKISKRSKLVPPDYTCQACQNKHKPSHWIYDCPDKVRMPGTNHVAKKAKGLHDPDA
RKLFVSGLPFEAKVKDIKAIFVSCGKLAHCKLIKFADTGRCKGQALLAFATEEAAEKALA
LDGSTLDNMPSKK
Download sequence
Identical sequences B7FTY5
XP_002178223.1.39622 2850.JGI44395 jgi|Phatr2|44395|estExt_fgenesh1_pg.C_chr_40171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]