SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI46435 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2850.JGI46435
Domain Number - Region: 293-319
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00523
Family Retrovirus zinc finger-like domains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI46435
Sequence length 572
Comment (Phaeodactylum tricornutum)
Sequence
MNSNQLSKSETNGERKPATIPLTLNASATAPDTLSETNPTFTNQNLSENGRNKSNDGYPS
ARENMHVAGLADVVLQEPTGLAPGFSPSTSSFVVGRFFQSGMSELFDLANFPTSDEKMKT
KDALLRYFLHRSQLPQSSPENRIEKEMDILQRSEGGVEEPLPSRRFATSSNKHAIASARN
NDFLKGPASKSFAELLEAIQLKKPPRSLYHGDAFRSGYSSISLDQVEAATRARHKSLISN
HSHERPSRTVHSFSLQFNEVSIASIANWGKNKQHNSITVSEKSRAARRRYFTVDSKFRKC
GICYRWGHYELECTSQTEDRSTVFGQEVTSIRSQPLDQQKKDVAIAWKQEYEAVVENCNG
YFIEQQKQRPKKPAKRKMQNAKKRGSSFDKTFMDGIVIKATGPSKLHDLSPLQQGEVVAW
MTDEKSMSDQKYVNAGVVVRTNINTGRVLLRFIDTIAPSPDSTCLVRNEGTSLWIALDAL
HRIEPDFDTARLGKKQRKKGSRKLKPARKAMTWKKTYRRKNQSKLNANGDGTMNPRITPR
KRSDGTYVAPRGRRPEGFEWEENRGLWISSQL
Download sequence
Identical sequences B7G175
jgi|Phatr2|46435|estExt_fgenesh1_pg.C_chr_100119 2850.JGI46435 XP_002180804.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]