SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI46890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2850.JGI46890
Domain Number - Region: 136-172
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000576
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 
Domain Number - Region: 220-255
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0179
Family Retrovirus zinc finger-like domains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI46890
Sequence length 257
Comment (Phaeodactylum tricornutum)
Sequence
MTAITIPFGASFRRANYAVSLYLEGSFLAIKKTICSARSLVLLTGNASEKKALIVDRSSN
SRSTTRALSQRFQEHQAGNGSSWTELHPPVRLVESIRYDEEDLRLEEDKITYKLMEKYGV
DKVRGGQFARSVFTQEQQFSLQQTLRHSIGACLRCGRPTHYASDCSELTDIHGTTIKISY
TFERSCPINSSTGNSNVPFCPSTPTIAEVSQSLASTPTTPAFDSDPCARCGRSTHDDSEC
DALTDIHGSLCDDEDNV
Download sequence
Identical sequences B5Y439
jgi|Phatr2|46890|estExt_fgenesh1_pg.C_chr_110299 2850.JGI46890 XP_002185773.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]