SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI47417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI47417
Domain Number 1 Region: 43-61,112-676,709-720
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 8.11e-135
Family Prokaryotic type I DNA topoisomerase 0.0000168
Further Details:      
 
Domain Number 2 Region: 976-1008
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000335
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  2850.JGI47417
Domain Number - Region: 796-831,909-951
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.028
Family Di-heme elbow motif 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI47417
Sequence length 1009
Comment (Phaeodactylum tricornutum)
Sequence
MDNGEKKSTTWQTLAWCTRNSFHMRLKRDKKLICRMRQNNVPTVLNVAEKPSVARALASV
FARLPNAVDRGMRREGNQVFSHENVCFPSVFSQGNGVCVQGPSTSQRAALYMITTSVRGH
LASQDFPPAYGWSKCDPIALFEAPIETSYRDDMQPLERMLKSLSRQAQVLILWLDCDREG
EAIGDEVRTVCLGSNSRLQVYRARFSTVLPVEIERALQTLGRVNEYMVAAVQARSTLDLR
VGAAFTRFQTLRLQRKFDGFAEQGVISYGPCQFPTLGFVVERWARIETFIPEDFWHLELA
ISVDDTYHQQSQEEDQSAARGRTQQNRTIHFSWKRGYLYDKLLTTVLFEECLEAGEAVVT
AMNGRTRNKWRPVPLATVELQKRASMYLRIGSETLMSAAEELYQQGYISYPRTETERFRP
EFEHRPLIQQFSSLQGEFGAYASKLLNENGFQIPRAGKSDDQAHPPITPAKAVDPNTIQD
QIQRKIYSLIVKHYLACCSRDAVGRGTTLTVRMGTEEFNATGLMVIEKNWLEIYSPWERW
GSGQGELPPLQVGSRIRPTSFLMKEGRSGPPQPISEVELISLMDRNGIGTDATIAQHIST
ILDREYARKDGRQKFLPTPLGIALVEGYNSMGYQLNKPDLRREMEAECNEVASGRKTKEE
IMVPILAKMKSCYETARAEARKLDEAVARHFPRLGAGESTSQVVEESFSECGVCRNSMAL
KQERENNNRTTARNTVRRKLLYCSTCRAGWTLPRGVVRPKTEQEDNGPPVKCPICQFQVI
RILRGEGYEGNGYHVCPKCFSDPPSDHGGASNAGDFRCFACQHPTCALASGTPGGDVEVF
RCPFCHPSAQPTSTSDSGKVCVRKTSRGYVLSCNKYVRGQDRCSYTIWLPKECHKVSVLS
GDENQNEICGRCSSPRAVIRKVHFVWKPGSVPPHLGRECTVCVLCDADFRRELNISLPQM
NQVQSRPRTTAGRAGHRGGGGTETGQGGAGNTCFHCGQPGHFANSCPNR
Download sequence
Identical sequences B7G3B1
2850.JGI47417 jgi|Phatr2|47417|estExt_fgenesh1_pg.C_chr_130239 XP_002181586.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]