SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI49439 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2850.JGI49439
Domain Number - Region: 214-235
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0602
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI49439
Sequence length 366
Comment (Phaeodactylum tricornutum)
Sequence
MVAGLKFLSKKSFNPQNLTNQKRVWERQERTKQEEKRVQQRARQLQRERDDEELAKSRGD
QPKLAFLYKPPPGLEGKANPNQRGPAVDLKETPAAHTETGRNDFVERQPGDNDAAAAFRQ
MLAAAAAPNYNDDNASNDEAPFSTKTIFGTVLQGTSVEATREKKTMSALEKAVGRNHDKN
TVTLDEQIQRFPALANAPRVKGVDETSSAVQFKPLGTQIRNVRCLKCGVWGHSRGDRECE
LSGWNPFNLRGSAPSATSIMPKKAVDKDGKSVEKETSHRAREERYSHSDECSSSSDTSEE
NRRRRKYKRRKQERHSSVDKERHKSYNRKRSHRDDTDVTADSDKVRRRRSRKQSRRDDSG
RRNGYR
Download sequence
Identical sequences B7GAL1
2850.JGI49439 XP_002184213.1.39622 jgi|Phatr2|49439|estExt_fgenesh1_pg.C_chr_220104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]