SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2850.JGI7430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2850.JGI7430
Domain Number 1 Region: 1-38
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000344
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 
Domain Number 2 Region: 40-80
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000128
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 
Weak hits

Sequence:  2850.JGI7430
Domain Number - Region: 88-108
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00016
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2850.JGI7430
Sequence length 109
Comment (Phaeodactylum tricornutum)
Sequence
CFRCDEVGHIEAECPNKPKPKPCSFCAQTDHEMYRCPLKVVCFNCGIPGHPSRACNMPRG
LPERRVCSICFHCGRPGHFLCKEMRWYFGLEGVTCANCGQAGHNIFDCK
Download sequence
Identical sequences B7FR89
2850.JGI7430 jgi|Phatr2|7430|gw1.1.876.1 XP_002176504.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]