SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 288000.BBta_1360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  288000.BBta_1360
Domain Number - Region: 106-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00366
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 288000.BBta_1360
Sequence length 148
Comment (Bradyrhizobium BTAi1)
Sequence
MSDMFVTLGTWNWLIFGIILMALELLAPGVFLFWLGLAALLVGLLSFAFAPGWQLQILMF
ALFAIAAVPLWRRLARTGAAAASDNPYLNRRSAALVGREFTLEKPIIDGNGTVRIDDTVW
RVAGPDAPAGSRVRIVQADGAHLTVTAA
Download sequence
Identical sequences A5EBQ0
2005385632 2005396255 gi|148252915|ref|YP_001237500.1| 288000.BBta_1360 WP_012041636.1.57540 2005240447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]