SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288000.BBta_7430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288000.BBta_7430
Domain Number 1 Region: 4-57
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000568
Family Terminase gpNU1 subunit domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 288000.BBta_7430
Sequence length 87
Comment (Bradyrhizobium BTAi1)
Sequence
MPQRYLRTPEAARFVGLSIRTLEKHRIYGTGPRYSKLGGRVVYRVEDLQEWVDAAAKAST
SDPGKAVVLPARRHSPAELEQARHPRR
Download sequence
Identical sequences A5ESZ5
288000.BBta_7430 gi|148258610|ref|YP_001243195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]