SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 288681.BCZK1879 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288681.BCZK1879
Domain Number 1 Region: 79-139
Classification Level Classification E-value
Superfamily NfeD domain-like 8.89e-16
Family NfeD domain-like 0.0028
Further Details:      
 
Weak hits

Sequence:  288681.BCZK1879
Domain Number - Region: 10-60
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0209
Family Clc chloride channel 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 288681.BCZK1879
Sequence length 142
Comment (Bacillus cereus ZK)
Sequence
MAAWVIWFIIAGILFIAEMLSITFYMLWLGIGAVVGGLIALFVPEALLLQVVAGAIVSLT
LTFFTKRISKNFREAKGFTDTVDMLAGKKGIVMQAITNEANGIVKVDGDTWTAIADNPID
AGEKVIVIKRHSTILQVKKESE
Download sequence
Identical sequences Q63C95
288681.BCZK1879 gi|52143357|ref|YP_083472.1| WP_000741992.1.29451 WP_000741992.1.30336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]