SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 288681.pE33L54_0005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288681.pE33L54_0005
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000266
Family DNA-binding N-terminal domain of transcription activators 0.013
Further Details:      
 
Weak hits

Sequence:  288681.pE33L54_0005
Domain Number - Region: 91-171
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00144
Family Apolipoprotein 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 288681.pE33L54_0005
Sequence length 196
Comment (Bacillus cereus ZK)
Sequence
MTDEIVYSASEVYKRLGISDSTLRKYMEVLQREKFVVKKDNRGRRQYTDNDIMVIEKLIE
LSKHDGMTLEKAAKMIVQQIEKVNPDLIQEEAAKTDLVPFHIKQQLQQQYSVMAQEMNQS
MLAMEKRLSEQAKQSNEEIKASVEAHNERVEKRLEARDETLMKTLREMQETKRMMQEFRD
EVAAAKEKKKPWWWFW
Download sequence
Identical sequences Q4V0Z6
288681.pE33L54_0005 WP_000128989.1.29451 WP_000128989.1.30336 gi|67078331|ref|YP_245949.1| gi|67078331|ref|YP_245949.1|NC_007105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]