SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 288705.RSal33209_2021 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288705.RSal33209_2021
Domain Number 1 Region: 87-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000196
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 288705.RSal33209_2021
Sequence length 166
Comment (Renibacterium salmoninarum ATCC 33209)
Sequence
MFEWLFENGWALWLIIFLALAVIEMLTLDLFFILMSVGALAAVVADLLGAPLWLQVIIFC
IVALAMILFVRPIALRHLHKGPNDLRTNVDRLIGHAAVVIEPVTSDGGRVKIGGDIWSAR
STNGAALAIGNNVEVTAIEGATAIVVAAAITPQSPHAEYPGTPAGA
Download sequence
Identical sequences A9WSG6
WP_012245424.1.55099 288705.RSal33209_2021 gi|163840763|ref|YP_001625168.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]