SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 288705.RSal33209_3418 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  288705.RSal33209_3418
Domain Number 1 Region: 98-394
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.8e-69
Family D-glucarate dehydratase-like 0.00059
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.77e-33
Family Enolase N-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 288705.RSal33209_3418
Sequence length 410
Comment (Renibacterium salmoninarum ATCC 33209)
Sequence
MKIIAADVIVSSPSRNFVTLKITTDEGFTGVGDATLNGRELAVASYLGDHLCQLLIGRDP
HRIEDTWQFLYRSSYWRRGPVTMAAIAAVDMALWDIKGKAAGLPVYQLLGGASRTGLRTY
GHASGRDLPELFYSVRENLAEGHTSVRIQTAVPGLKAIYGIAAQEQSSGERYDYEPAGRG
AFPAEEDWDTRAYLNHLPSVFEAVRNEFGPDLPLLHDGHHRMTPIQAAKLGKSLEPYDLF
WLEDCTPAENQEALRLVRQHTTTPLAIGEVFNTVWDFQTLIREQLIDYVRAASTHFGGIS
PLKKVMDYAAQYQIKSGFHGPTDISPVGFAAQCHVGLAIHNYGIQEYMLHSPQTNEVFQQ
SLSFSGGLIRLDPNAPGLGIELDEEAAARYPYQQAYLPYNRLADGTVHDW
Download sequence
Identical sequences A9WVA7
288705.RSal33209_3418 gi|163842137|ref|YP_001626542.1| WP_012246762.1.55099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]