SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 289376.THEYE_A0592 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  289376.THEYE_A0592
Domain Number 1 Region: 31-197
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.39e-29
Family Clp protease, ClpP subunit 0.032
Further Details:      
 
Domain Number 2 Region: 368-435
Classification Level Classification E-value
Superfamily NfeD domain-like 9.42e-16
Family NfeD domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 289376.THEYE_A0592
Sequence length 436
Comment (Thermodesulfovibrio yellowstonii DSM 11347)
Sequence
MANRELLNKHLLSLIKYFICLLISFLSTSVYAKEIIVLTVNGVINPPHAEYTIKGIQKAH
EQNAEAVIIQLDTPGGLDTSMRSIIKEMLNSQIPIVVYVSPKGARAASAGAFITLAAHIA
AMAPGTNIGAAHPVAMGGEKMDKTMAEKITNDAVAYIKSIAKQRGRNIEWAEQAVRKSIS
STETEALKLKVIDLIADDLNSLMKDINGMKVKTARGEVTLNTKTAKINKIEMNFREKLLN
FISDPNIAYILLMIGIYGIIFELSNPGAILPGVIGAISLILAFYSLQTLPINYAAAGLIL
LGVILFILELKFTSHGLLTLGGVICFILGSIMLFDTANPLFKLSLSVIIPVTLVTALFFG
VLLRLAYKAHKRKPVTGVEELIGLKGIAKTDIDRHRGMVMVHGELWQAVSDEEIKKDEEI
IVEEVKGLTLKVRRAN
Download sequence
Identical sequences B5YJM0
YP_002248435.1.25208 289376.THEYE_A0592 gi|206891158|ref|YP_002248435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]