SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 289376.THEYE_A0825 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  289376.THEYE_A0825
Domain Number 1 Region: 116-257
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.21e-41
Family Potassium channel NAD-binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 12-137
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.13e-19
Family Voltage-gated potassium channels 0.0012
Further Details:      
 
Domain Number 3 Region: 245-334
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 5.75e-17
Family TrkA C-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 289376.THEYE_A0825
Sequence length 340
Comment (Thermodesulfovibrio yellowstonii DSM 11347)
Sequence
MLPVIYIAIVNLIHRKFVFVSILLVSILLFGTFGYMIIEDMRFIDALYMTVITLATVGFK
EVKELDENGKIFTIILILTGFGVFTYTLTVGAKILIEGEIKEVFKKRKMRKKVENISGHY
VICGYGRMGSIIVKELKANNIPVVIIEKNKTNLPEDEDIIYVEGDATHDEVLKSAGIEKA
AGLITVLPSDAENLYVVLSARELNPNMFIVARAVDKEAEPKLKRAGANKVVSPYFIGGLR
IAHTVLRPTVVDFLEFATRSEHIEIQIEEIEVSHRSTLIGKTIAQSGIGRDIGVIILGIK
RADGRMKFNPTSQTLIKEGDTLIVIGQIDKLLLLETLAKG
Download sequence
Identical sequences B5YKA1
YP_002248666.1.25208 289376.THEYE_A0825 gi|206890350|ref|YP_002248666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]