SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 289376.THEYE_A0907 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  289376.THEYE_A0907
Domain Number 1 Region: 4-189
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.84e-53
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 289376.THEYE_A0907
Sequence length 190
Comment (Thermodesulfovibrio yellowstonii DSM 11347)
Sequence
MEKVEIRWHGRGGQGTVTAAKVFADACLSGGRYVQAFPEYGPERAGAPLRAYNRVSSKEL
RMHCPVSNPDVVVVVDPTLIESIDVTEGAKDDAKFIINSSKEAAELRKKLNLKPTQKLYV
LDATKIAIDCFGRPMPNSPMVGALNKVTGLVNLETLLEDVKKSFGKKFSQKIIDGNLLAV
KRGYEEVKEG
Download sequence
Identical sequences B5YKH8
gi|206890146|ref|YP_002248743.1| WP_012545865.1.25233 YP_002248743.1.25208 289376.THEYE_A0907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]