SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 289380.CPR_1131 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  289380.CPR_1131
Domain Number 1 Region: 72-137
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000327
Family NfeD domain-like 0.0054
Further Details:      
 
Weak hits

Sequence:  289380.CPR_1131
Domain Number - Region: 14-69
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0262
Family Haloperoxidase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 289380.CPR_1131
Sequence length 137
Comment (Clostridium perfringens SM101)
Sequence
MLWLWVVVILAGIIIDYLSSDVLFVGFSFGALGGLLLAFLDVNVILQFILFSIITILFFF
YVYPKIKRKIKADNLGTKTMEQSYIGRKIILDENVEDSSLIKFEGIYWTFKSVSGPLKKG
TEVEIIGIEGNKILIKK
Download sequence
Identical sequences Q0STV4
289380.CPR_1131 gi|110803232|ref|YP_698453.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]