SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CKN9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CKN9
Domain Number 1 Region: 92-123
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000203
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Weak hits

Sequence:  28985.Q6CKN9
Domain Number - Region: 4-52
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0392
Family Coiled-coil dimerization domain from cortexillin I 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CKN9
Sequence length 129
Comment (Kluyveromyces lactis)
Sequence
MADADKIIKQSEALDQLAKLVLSQSQKKQSTLPSLKEEYENKLKNVDELISMITSVELDK
EKFSKMISKQIEIIQKDGQEYALIPVQRTPKQAKFGKRKSKANNIKCSYCNETGHLRSKC
EKKLLGVPP
Download sequence
Identical sequences Q6CKN9
gnl|GLV|KLLA0F09229g 28985.Q6CKN9 XP_455500.1.35115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]