SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CNA4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CNA4
Domain Number 1 Region: 543-677
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CNA4
Sequence length 706
Comment (Kluyveromyces lactis)
Sequence
MAFQDLNAVLLDKKGTPTDTSPSKKYGTGSCIGADTSFNDVQSTSTSTVGLKFSTVSFPE
NERVTLKDTIPYYLPCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLC
GLYSLVFSPAVYTVLGSVPQMIVGPESAISLILGQAIEARLSEDPKLKAINICLVITFIS
GLVLLTGGLLRLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSP
FEKVLFIMKYGPENYHKPTAILSLVAFVILMSLRIFKKRYGKKFKWLVLLPDILVVVALS
IFVSYKMHLKSRYGIEIINDIPKDSMKHLKNPFSNVNVATFKDLFSTGFMVAMLGFFESA
TASKSLGTSYNLAISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGF
FMGLVTLFTIQFLLPIIRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFT
VTLLATLFYSLEAGIYIGCACSIINVIKHSAKSRIQILGRVPGTETFINADDYQANAAGY
FINPQIEEIEGFLIVKIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENV
IFDMKGMTHIDSSAAQTLEEILSAYNRRDVHVFLTNVPLTEKVRERLVTSGVAELCERNT
ITNSSYFSTIEDALTAADVIAQRHNQQYHTPPPSIFSNTLLNSSMA
Download sequence
Identical sequences Q6CNA4
XP_454585.1.35115 gnl|GLV|KLLA0E14059g 28985.Q6CNA4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]