SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CPI0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CPI0
Domain Number 1 Region: 887-1042
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000387
Family cAMP-binding domain 0.02
Further Details:      
 
Domain Number 2 Region: 724-840
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000165
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CPI0
Sequence length 1060
Comment (Kluyveromyces lactis)
Sequence
MSTAQNSSVSMSQSQSTAKNRKYSFQMPTTSTYLGRSYVGSFISPPMEYRSNSNTTSNNN
NNSNVGDPFKSPFSSEGSKLIHESGNLHKQTAFLSNTFDNDAGNDEGAGFPLDGNDDEFN
LEQNDIDMIVEEDQMLQNSQRRRGRMSVDAAADIEADAHLMDLEDMALKRADDVGIFSTS
FPGKDDSSFLDVSDSTENLALLPTNSHNSMYVEYGTFDEENQPATQYISLLPDGASSGGF
TSQGFRSSMSHYDKARDLMLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGP
TGLSMFYVSTVICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGNDNKVIS
TTIVCYALSSIITGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVP
EFKYSWQFLSSLFTDFDILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVV
ALVPSLSLDKLRDFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGIL
HVPINVPALAMSLNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSP
IAGIMLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTI
WIIVITMGVVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFL
RNIGEQIYVLKLQNILFFGTIISIEEKVNSLLEICESDSSKKRIKYLILDFKNIRAKSID
YSAAEGFNRIKRFLEKERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCEN
EFLMRYKRIRTKTRARKLAQLKKSQNRMSKLPVNTPRNHQFVSEVRNIYTEEMEIQKLSN
ELKERQQFLPIFLMSIRKFRNAIQSPNELKRTNELDLWKRLISYFQQKKFPPNTEIRHRN
NMFIVVESGVLNLTHHLIQGEFYETMSPKTAYGVISNVNSDPLAVSITTDTECVLRYIDA
ESLADLKLTDPELFTELLILVMAIHRDRFRELLGYSLISM
Download sequence
Identical sequences Q6CPI0
28985.Q6CPI0 gnl|GLV|KLLA0E04731g XP_454159.1.35115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]