SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CTG7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CTG7
Domain Number 1 Region: 277-356
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000192
Family U-box 0.074
Further Details:      
 
Domain Number 2 Region: 160-194
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000122
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CTG7
Sequence length 424
Comment (Kluyveromyces lactis)
Sequence
MSSTIYYKFRSQKDTFRVGFDGTGITVFDLKREIINDNKLGDGTDFQLKIYNPDTLEEYE
DDTTVIGRSSMVIAKRCPSVKLSVNGKSVIGNATRYVMGKPRVMSKRAMTPSVTSSGNAK
VEGQTEEERIANMFANQETQWEQTQQEMSQAQPIFQQRNVGSAPGQDQEPPPPGYMCYRC
GGRGHWIKNCPTNNNPNFEGKRIKRTTGIPKKFLKSIEIDPSSMTPEEMAEKKIMVTDEG
KFVVHMADQTSWEDYQRRQQQQSYMMSQEDKLYMKGQFPDLPDELKCCLTGGLLRDPVKC
TKCCGKVVSRLAMEDALLESDFVCPLCQTSDILLDSLEPVQEIQRKVQEFIKQNKKRLLE
EEPVAGAAPVAETGVKKPKVMPPPPVPFMPFMFPMAPFFGVPSSTQQVQPQNQNQQEPSV
QPKN
Download sequence
Identical sequences Q6CTG7
gnl|GLV|KLLA0C12837g 28985.Q6CTG7 XP_452772.1.35115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]