SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CTW0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CTW0
Domain Number 1 Region: 22-166
Classification Level Classification E-value
Superfamily EF-hand 8.66e-41
Family Calmodulin-like 0.0000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CTW0
Sequence length 167
Comment (Kluyveromyces lactis)
Sequence
MNNRRPSGRVAKSVDKSTLQKELLEEQKQEIYEAFSLFDMNNDGYLDYHEFKVALRALGF
ELSKGDILELIDRYDADGRRLIQYEDFYLVVGEKILQRDPLDEIKRAFRLFDDDNTGKIS
LKNLKRVAHELGENLTDEELRAMIDEFDLDDDGEINEEEFIAICTDN
Download sequence
Identical sequences Q6CTW0
28985.Q6CTW0 XP_452629.1.35115 gnl|GLV|KLLA0C09669g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]