SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CUR7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q6CUR7
Domain Number 1 Region: 115-155
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000157
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Domain Number 2 Region: 43-83
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000192
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 
Domain Number 3 Region: 3-41
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000384
Family Retrovirus zinc finger-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  28985.Q6CUR7
Domain Number - Region: 87-113
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000157
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CUR7
Sequence length 156
Comment (Kluyveromyces lactis)
Sequence
MSGKACYICGKLGHLASDCDSEKLCYNCNKPGHVQSECTVPKTVEFKQCYNCGETGHVKT
ECTVQKCYNCDGFGHISRECDQPKRFRNNERSGPKVSCYKCGGPNHIAKDCLKSEPTCYN
CGQAGHLSKDCQNGENEKVCYNCNGVGHIAKDCSSY
Download sequence
Identical sequences Q6CUR7
XP_452322.1.35115 28985.Q6CUR7 gnl|GLV|KLLA0C02805g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]