SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 28985.Q6CXA1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  28985.Q6CXA1
Domain Number - Region: 962-991
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0907
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28985.Q6CXA1
Sequence length 1033
Comment (Kluyveromyces lactis)
Sequence
MPRVAGSSGSKKQGKAKKDFSNEDDAYNALFGGEFGALDISNYTSGGGNGKQDETEHLPN
AIDFEDEDELADEELPEEEEPSHSPNRHNEGSFQRSLTEDDEYMTLMDHGDVMHEVDAAG
FEVQGNNALFMESTYQSFGPEQHQFNEYDEQHRRLMEEQRRKQEEQNAKEEQLLFQSYFP
ELKPGRVLRMTKIAPKPLAKYQWQRELYLRNRILKPLIPIKVKFQVQKDTKKLFKMRSKS
VKPWQSAISEFSEVQRRNVIKVAYDEIYKEDTVDDKKDEHDEVIPEDLLIVADEWDYEKI
VDDRENEEPMTSNKRNPPAVENTLEEDGKDWEWNEDDIINGKVSAKEPPIDMNDERLLIL
PNENKIESAQKVVKPLIPYNEKSLLAKFNISNDDTYKILKKNYQKKIRSTISNLNIEHSQ
PATRLQSPFYKVVLPKDQLRHFHRNHFGKRIRPGTNIVFSKIKTRKRKKDKGKDVHEIFQ
HSADLTVGDSAQVFLMEYSEQQPVALSKFGMANKLINYYRKTGETDSSRPKLPVGETHVL
GVQDKSPFWNFGFVSPGNIVPTLYNNMVRAPVFKHEVSKTDFLLVKSLGNGSGNRFYLRQ
INHLFAVGQTFPVVEVPGPNSRKVTAMGKNRLRMVVYRILNKSPENRLLVKQVARHFPEQ
NDMQNRQRLKEFMKYQREGDDQGFWKLKEGEVLLDNENVKKMVTPEDVSLVESMYYGQQF
QEDIDFYNFDERAKELEENLIFWNATKNFLNATQMRAMIQIHGPGDPTGCGEGFSFLKTS
MKGGFVKSGSKDQPQIAGGHSYNVAQQQKAYEEEISRTWYNQAKSLSIQNPFEEMDDPDI
VNESNKHVPSTRPDEKVLRITRKKRDSNGIIQRQTVIVRDPRVIQGYLRAYEKRREEAER
NLGLDELINDNITIVGGENEEERQLKQKKLLEEQLAKLEKSKERRQARKAAREKTKDGKV
SKSKNTTRRCATCGAIGHIRTNKSCPMYNGGVAANAAAAQGSNGTSTSKVGTESSTPIAP
STPSASVPDLGDN
Download sequence
Identical sequences Q6CXA1
28985.Q6CXA1 XP_451438.1.35115 gnl|GLV|KLLA0A10021g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]