SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28985.Q9Y854 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28985.Q9Y854
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.5e-34
Family Ubiquitin-related 0.0000249
Further Details:      
 
Domain Number 2 Region: 76-128
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.38e-17
Family Ribosomal protein L40e 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28985.Q9Y854
Sequence length 128
Comment (Kluyveromyces lactis)
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQ
LRPKKKLK
Download sequence
Identical sequences A0A1G4KDK0 A0A1G4MEA3 A0A1S7HLN1 F2Z6I9 G8BS20 I2H4G2 Q6FTH4 Q9Y854 S6EMP5
28985.Q9Y854 XP_003685529.1.77742 XP_003685554.1.77742 XP_004180783.1.8396 XP_446470.2.27851 XP_451025.2.35115 gnl|GLV|CAGL0G02475g gnl|GLV|KLLA0A00616g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]