SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290315.Clim_0618 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290315.Clim_0618
Domain Number 1 Region: 799-1183
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.24e-123
Family PFOR PP module 0.0000000203
Further Details:      
 
Domain Number 2 Region: 422-673
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.93e-80
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000744
Further Details:      
 
Domain Number 3 Region: 4-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.44e-75
Family PFOR Pyr module 0.000000074
Further Details:      
 
Domain Number 4 Region: 259-420
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.27e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000833
Further Details:      
 
Domain Number 5 Region: 670-843
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.08e-22
Family Ferredoxin domains from multidomain proteins 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290315.Clim_0618
Sequence length 1186
Comment (Chlorobium limicola DSM 245)
Sequence
MSRTFKTMEGNEALAHISYRTSEVISIYPITPASPMGEYSDAWADLGKTNIWGTIPKIDE
LQSEAGAAAAVHGALQTGALTTTFTASQGLLLMIPNMYKIAGELSPCVIHVSARSLAAQA
LSIFGDHGDVMSVRGTGFALLASSSVQEVMDMALIAAAATLESRIPIMHFFDGFRTSHEI
SKIEVVPDEIIKAMVSDELVIAHRNRRMSPDAPTIRGTSQNPDVYFQGRETVNKFYEACP
GIIERLMDKFGELTGRHYKPYQYYGAPDAERVIILMGSGVEAVRETVEFLNLTGEKVGVI
NARLFRPFDIERFVKALPASVRSISVLDRVKEPGSAGEPLYLDTVNALLEGFNNGLIKAI
PAITGGRYGLSSKEFTPTMVKAVFDNMASGSPKNHFTVGITDDVTGSSLDYDRTFAIEPD
EVFRAIFYGLGSDGTVGANKNTIKIIGENTPNYAQGYFVYDSKKAGSITTSHLRFGPKQI
HSTYLVSEAHFIGCHHWIFLEMIDLVKNLKQNGTLLLNSHYAPEELWDKLPKIVQEHLIR
KQAKLYTIDAYKVAQASGMGQRINTIMQACFFAISGVLPREEAIEKIKDSIRETYGKKGD
EVVNQNIQAVDNTLANLHEVTIGSVAESNKELRSPIVGEAPEFVCNVLARIIAGEGDDIP
VSDMPVDGTYPTGTSKFEKRNLAENIPVWEPDLCIQCGKCSLVCPHAAIRAKVYDANYLA
NAPKTFKCIDAKGASWAGMKYTIQIAPEDCTGCDMCAHVCPGKDRTNPERKALEMYPQAP
LRDAEIDNWNYFLNIPEYDRNKINVRLIKEQQLQQPLFEFSGACAGCGETPYVKLMTQLF
GDRLVVGNATGCSSIYGGNLPTTPYSTNAAGLGPTWSNSLFEDTAEFALGFRSSIDKQRE
YAMELVKRMASEIGESLATEILEAKEINEPEIFEQRKRISVLKDKLQQIDSADARNLLSV
ADMLVKKSVWGVGGDGWAYDIGYGGVDHVTAGNKNINLLVLDTEVYSNTGGQASKATPKA
AIAKFAAAGRVTNKKDLGLISMSYGTAYVASVALGARDDQTLKAFLEAEAYDGPSIIIAY
SHCIAHGINMATGLDNQKAAVDSGHWLLYRYNPDLLKEGKNPLILDSKKPKMPIAQFLDN
ENRFRMLKKSHPALAEQYYAEIQKAVDARWAHYEYMAARSFDELKA
Download sequence
Identical sequences B3EH25
gi|189346155|ref|YP_001942684.1| 290315.Clim_0618 WP_012465586.1.84751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]