SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290315.Clim_0864 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290315.Clim_0864
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.99e-30
Family Clp protease, ClpP subunit 0.01
Further Details:      
 
Domain Number 2 Region: 382-445
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000235
Family NfeD domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290315.Clim_0864
Sequence length 447
Comment (Chlorobium limicola DSM 245)
Sequence
MFSPNILSMAGFGYFRNCVAFLFILVSVLFPSGQGYAAEQVTVSRIVLTGSVNPASADYF
SRALEQAHADGSVALLVELDTPGGLVSSLRLMVQDVLASKIPVIVYVSPSGAQAASAGAL
LMLSAHVAAMSPGTEIGAAHPAGMGGGDKDGDVMSKKAASDLAAYARSLAELRGRNPEWA
EQAVRQSRASSAQEAIRIGVIDLIAATPSMLLREIDGKRVKVGGRELVLETARARLSVIE
PAFQEQALMRIADPNIAYILFLAGLVGLYFELANPGAIFPGVAGAVSLLLGLYAMQMLPV
SITGALLLALGVLFLGLELFVTSGGVLAIAGLIALFAGSLMLFGTPGSGTELSLFVFLPV
FVVFAVAAGAIVRVVLSSSSARQLSGQEGLLGESGRVVRQIERASAGKVFVHGELWEAVA
DEKLPEGTSIRVTGITGLQLQVTKTEE
Download sequence
Identical sequences B3EIB3
WP_012465822.1.84751 290315.Clim_0864 gi|189346393|ref|YP_001942922.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]