SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290315.Clim_1648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290315.Clim_1648
Domain Number 1 Region: 438-543
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000128
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290315.Clim_1648
Sequence length 568
Comment (Chlorobium limicola DSM 245)
Sequence
MFKPKFFSVLSELTPQQIARDVTSGILVGIVALPLAIAFAIASGVSPEKGLITAVIGGFI
VSFLGGSRVQIGGPTGAFIVILYGIVEQYGVNGLMIATIMAGVILMLMGFAQFGSLIKFI
PYPVVVGFTSGIAVIIFSSQISDFLGLGIDKVPADFIDKWIAYGRHLSAINPESFLVGLL
SLLIIVFWPRVSKKIPGSIIAIIAATVLAHYLKLDVATIESRFGEIPSALPAPAFPVFDF
ATVKQLIMPATTIALLGAIEALLSAVVSDGMIGSRHKSNMELVAQGAANIISPLFGGIPV
TGAIARTATNVKNGGRTPVAGMVHALTLLLIMMLFGKWAKLIPMPTLAAILIVVAWNMSE
HNVFRKLLKSPKSDVVVLLTTFGLTVVFDLTIAIEIGMLLSVFLFMQHMASLANVNIITR
ELKDREEEDDPNTISTRSVPDGVEVFEISGAMFFGAASKFKDAMHIVEKAPKVRIIRMRN
VLSIDATGLNMLQELLADSRKTSTHLILSGVHAQPLFAMQQYGIYDDIGETNIFGHIDDA
LDRSRELLGLPKMGKQKDFVPSVQRDNQ
Download sequence
Identical sequences B3EDY9
290315.Clim_1648 WP_012466564.1.84751 gi|189347141|ref|YP_001943670.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]