SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290315.Clim_1836 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290315.Clim_1836
Domain Number 1 Region: 14-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.55e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290315.Clim_1836
Sequence length 117
Comment (Chlorobium limicola DSM 245)
Sequence
MAFRLETQNGITIGIAELDERLDAENSKALQKACGDWQQQTPFLVFDCTKLDFIDSSGLG
AIVSCLRRSLEKNGDLKLAGLNAKVSMVFELTKAKKLFSIFSNASDAAASFAVSRQP
Download sequence
Identical sequences B3EF13
290315.Clim_1836 WP_012466748.1.84751 gi|189347325|ref|YP_001943854.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]