SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290317.Cpha266_0748 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  290317.Cpha266_0748
Domain Number - Region: 66-120
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00235
Family Sfri0576-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290317.Cpha266_0748
Sequence length 124
Comment (Chlorobium phaeobacteroides DSM 266)
Sequence
MGIQYTTNVDGDTLLVHASGFDENLSDVQNYATGIINACMQSGVTRVLCDETALEYRLGT
FDTYRAGEFLSTNVPALAKIAIICNPVFLSNANFFENVVVNRYLRLRIFTETEPARDWLN
NPET
Download sequence
Identical sequences A1BEH4
290317.Cpha266_0748 gi|119356581|ref|YP_911225.1| WP_011744630.1.8298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]