SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290317.Cpha266_1160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290317.Cpha266_1160
Domain Number 1 Region: 40-203
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.98e-31
Family Clp protease, ClpP subunit 0.024
Further Details:      
 
Domain Number 2 Region: 378-441
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000103
Family NfeD domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290317.Cpha266_1160
Sequence length 445
Comment (Chlorobium phaeobacteroides DSM 266)
Sequence
MMVIGRIRWSRVFAVRFFFIAVVSAIALISSPADGAENLVSRIVLKGSVNPGSAGFFSRA
LHDARRSGSDAVLVELDTPGGLVSSLRSMVQEIMASPIPVIVYVYPSGAQAASAGALLML
SAHVAAMAPGTEIGAAHPVGAGGKSDGDETMKKKVVNDLAAFARSLAEKRGRNAQWAEKA
VTESVSSTAQEALQAGVIDMISDNPSEVLSRLRGMKIMTVAGEKGFTGASFTIREIRPTF
KESALMTIADPNLSYILFLAGIAGLYFELATPGAIFPGVAGAISLLLGLYSMQTLSVNVT
GLLLLLLAVLFLGLELFVTSGGILAVAGLVALFAGSIMLFDLPGSGITLSLQVILPVFVL
FSIGIALLLRVVFRSGKEPPLMGKSALIGQSGRVVRFIETDKPGKVFVHGELWDASSSEC
IVEETVVVVTGIEGMELKVKTKQKE
Download sequence
Identical sequences A1BFM0
gi|119356977|ref|YP_911621.1| 290317.Cpha266_1160 WP_011745021.1.8298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]