SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290317.Cpha266_2336 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290317.Cpha266_2336
Domain Number 1 Region: 3-52,112-139
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000896
Family Cgl2762-like 0.04
Further Details:      
 
Weak hits

Sequence:  290317.Cpha266_2336
Domain Number - Region: 65-146
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.011
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290317.Cpha266_2336
Sequence length 161
Comment (Chlorobium phaeobacteroides DSM 266)
Sequence
MGYSHAVSQSLLKKVLPPEGRSISEVSRETGVNDQTIRNWIKRSKTGILADGNQDSCPRF
LRPKEKYQLVVEAAGIDDEQLGEFLRERGLHSEHITIPDQELRNMIDNKNDQQDKENKAL
KKKIKELEKELQRKEKALAEAASLLILKKKLDALTREHEDD
Download sequence
Identical sequences A1BIU9
WP_011746112.1.8298 2005163640 290317.Cpha266_2336 gi|119358106|ref|YP_912750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]