SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290317.Cpha266_2545 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290317.Cpha266_2545
Domain Number 1 Region: 180-296
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.26e-28
Family Homoserine kinase 0.0018
Further Details:      
 
Domain Number 2 Region: 4-172
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.14e-27
Family GHMP Kinase, N-terminal domain 0.0000819
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290317.Cpha266_2545
Sequence length 320
Comment (Chlorobium phaeobacteroides DSM 266)
Sequence
MKTVRGFASATVGNVACGFDVLGFAITEPGDEVILTLHEERKSECPVSITAISGDGGALP
LDPKKNTSSFVVLKFLEYIRTSKGIDFKGHIDLELKKNLPLSSGMGSSAASAAAALAAAN
ELLGQPCSKMELVHFAVEGERVACGSAHADNAAPAILGNFVLIRSYAPLDLITIPSPEHL
FCTLVHPHTELKTSFARSVLPRSIPLKTATQQWGNVGALIAGLLKSDYDLIGRALVDVVA
EPKRAPLIPGFLDVKHAAIDCGALGCSIAGSGPSVFAFSSSKETAERVGQAMREAFLLPE
TNLKSDMWVSPICKEGAKVL
Download sequence
Identical sequences A1BJF6
gi|119358313|ref|YP_912957.1| WP_011746310.1.8298 290317.Cpha266_2545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]