SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290318.Cvib_0578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290318.Cvib_0578
Domain Number 1 Region: 30-156,267-381
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.11e-54
Family Phosphate binding protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 152-258
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-23
Family Voltage-gated potassium channels 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290318.Cvib_0578
Sequence length 383
Comment (Prosthecochloris vibrioformis DSM 265)
Sequence
MHTPLQNHPRTPILSQSIAKKTCRACRIGFALLSLVAITIIMTTGTRDASARARELTVAT
KHSPPFAMQKENGEWEGISIDLMRAIAKKQDLGITFIPMSLPDMIEAVAVRRVDIAAAAL
TMTVEREEQLDFSHPYFQSGLAIAVREKDDGWEYALRRLFSPAFLKVLGGLSLLLLLSGF
LVWVFERRNNPDNFGGGPVEGIWSGFWWAAVTMTTVGYGDKAPKTPPGRIVALIWMFTSL
VVISGFTAAMTTSLTVGSLGTGIRQVDDLYGKKIGTVKASTSSRFLDELAIRGQNFPTVN
DALHLLEQGKLDAVVYDEPILRYLITTGEIHGIKVVNRSFRHEYYALALPPRSTERETLN
RNLLEIINSKDWKEIRFKYLHNE
Download sequence
Identical sequences A4SDP1
gi|145219393|ref|YP_001130102.1| 290318.Cvib_0578 WP_011889828.1.67172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]