SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290318.Cvib_0917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290318.Cvib_0917
Domain Number 1 Region: 418-511
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000137
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290318.Cvib_0917
Sequence length 522
Comment (Prosthecochloris vibrioformis DSM 265)
Sequence
MKTTMNVRSFNSIFSPALILHHQTDSMSERIKNEWFSSIRPDLLSGLVVALALIPEAIAF
SIIAGVDPKVGLYAAFSIAIITAFTGGRPAMISAATGAMALLMVTLVRDHGLQYLFAATI
LTGLLQIAAGYFRLGSLMRFVSRSVVTGFVNALAILIFMAQLPELTNVSWHVYAMTAGGL
ALIYLFPLLPVIGKSLPSPLVAIILLTGIAIATGLDIRTVGDMGELPDTLPVFLWPEVPL
NMATLSIIFPYSIGLATVGLLESMMTATIVDDLTDTKSDKNRECRAQGIANIGAGLIGGM
AGCGMIGQSVINVKSGGRGRLSSFSAGLFLLIMVVFFDAWIRQIPMAALVAVMIMVSIGT
FSWESLLNLRKHPPSTSIVMLVTVITVVSTHNLAIGVFAGILLASLFFANKVGHFMLIKK
ELDSSGTTRTYRVIGQVFFASADKFTDSFDFREAAANIVIDLSGAHFWDISAVSALDRAV
IKFRREGTQVEIIGMNDASATIVDRFGVHDKPEEVEKILSGH
Download sequence
Identical sequences A4SEM2
290318.Cvib_0917 gi|145219724|ref|YP_001130433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]