SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290318.Cvib_1407 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290318.Cvib_1407
Domain Number 1 Region: 799-1181
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.83e-121
Family PFOR PP module 0.0000000205
Further Details:      
 
Domain Number 2 Region: 421-673
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-77
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000785
Further Details:      
 
Domain Number 3 Region: 4-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.53e-76
Family PFOR Pyr module 0.0000000758
Further Details:      
 
Domain Number 4 Region: 260-420
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.2e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000939
Further Details:      
 
Domain Number 5 Region: 670-843
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.91e-23
Family Ferredoxin domains from multidomain proteins 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290318.Cvib_1407
Sequence length 1182
Comment (Prosthecochloris vibrioformis DSM 265)
Sequence
MSRTYKTMEGNEALAHISYRTSEVICIYPITPASPMGEYSDAWAADGVKNLWGTVPRIDE
LQSEAGAAAAVHGALQTGALTTTFTASQGLLLMIPNMYKIAGELSPCVLHVSARSLAAQG
LSIFGDHSDVMSVRGTGFSMLASSSVQEVMDMALISAAATLESRVPIMHFFDGFRTSHEI
AKIEVVPDEVIREMISDDQVIAHRKRAMTPDAPTIRGTSQNPDTYFQGRETVNTYYDAAP
SITQKMMDKFGELTGRSYKVYQYYGAPDAEMVVVLMGSGVETVRETVEYLNKNGEKVGVV
NVRLYRPFDIKRFLAAFPATVKSVSVLDRLKEPGSAGEPLYLDTVNAFIEGVAGGYRKTM
PALSGGRYGLSSKEFTPAMVKAVFDNMASAAPKNHFTVGITDDVTNLSLEFDRGFSIEPD
EMFRALFYGLGSDGTVGANKNSIKIIGENTPNYAQGYFVYDSKKAGSITTSHLRFGPKEI
HSTYLVSEAQFIGCHHWIFLEMINLVKNLKKGGTLLLNSHYAPEEIWDNLPRLVQEHLIR
KEAKLYTIDAYKVAQGSGMGQRINTIMQACFFAISGVLPRQEAIEKIKDAIRATYGKKGD
EVVRQNIQAVDDTLANLHEVAIGTVADSTKKLRDPIVGEAPEFVCNVLARIISGEGDDIP
VSNLPADGVYPVGTAKFEKRNLASEIPVWESDLCIECGKCAMVCPHAAIRAKVYDPKFLE
NAPRTFKSIEAKGTSWAGMKYTIQVAPEDCTGCRICANICPARDKADPERKALVMQPQEP
LRETEVDNWNFYLNIPEFDRTKINTRLIKEQQLQEPLFEFSGACSGCGETPYVKLMTQLF
GDRLVIGNATGCSSIYGGNLPTTPYTCNAQGLGPTWSNSLFEDTAEFALGFRVSIDKQQE
YAQELLQRLSSTVGDTLVGEILGAVQTTEPEIFEQRKRVANLKEKLAAVDSADAKNLLSV
ADMLVKKSVWGVGGDGWAYDIGYGGVDHVTAGDKNVNLLVLDTEVYSNTGGQASKATPKA
AIAKFAAAGRPVNKKDLGLISMTYGNAYVASVALGARDEQTLKAFLEAEAYDGPSIIIAY
SHCIAHGITMEHGLANQKAAVDSGHWLLYRYNPDRLKEGKNPLQLDSKKPKIPVADFLNM
ENRFRMLKKSHPEVAEQYFAEIQKAVDARWSHYEYLAARTFS
Download sequence
Identical sequences A4SG09
WP_011890641.1.67172 290318.Cvib_1407 gi|145220211|ref|YP_001130920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]