SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290318.Cvib_1615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290318.Cvib_1615
Domain Number 1 Region: 139-435
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.36e-123
Family Enolase 0.0000000112
Further Details:      
 
Domain Number 2 Region: 4-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.2e-56
Family Enolase N-terminal domain-like 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290318.Cvib_1615
Sequence length 437
Comment (Prosthecochloris vibrioformis DSM 265)
Sequence
MPIIRKIHARQILDSRGNPTVEVDVYTESSFGRAAVPSGASTGVHEAVELRDGDASVYLG
KGVLKAVENVNTIVDEGLRGMLVTEQEEIDRMLLELDGTPNKSKLGANALLGVSLACAKA
GAEYSGMSLYRYIGGTMANTLPVPMMNVINGGAHADNTVDFQEFMIMPIGFTSYSDALRC
GAEIFHALKALLKSRGLSTAVGDEGGFAPNLTSNEEAIELVVEAIGKAGYKAGSPASKGG
LGEGQVMIALDPASSEFYDADKKKYVFKKSDKRELSSEEMAAYWEKWSNDYPIISIEDGM
AEDDWAGWKMLTDRIGSRVQLVGDDLFVTNSVRLAEGIEKKVGNSILVKVNQIGTLTETL
EAIDLAKRNGYTAVISHRSGETEDSTIAQIAVATNAGQIKTGSMSRSDRMAKYNELLRIE
EELGAQAVYPAAKAFRV
Download sequence
Identical sequences A4SGL6
290318.Cvib_1615 gi|145220418|ref|YP_001131127.1| WP_011890848.1.67172 2005137444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]