SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290338.CKO_02652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290338.CKO_02652
Domain Number 1 Region: 96-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000262
Family NfeD domain-like 0.0065
Further Details:      
 
Weak hits

Sequence:  290338.CKO_02652
Domain Number - Region: 32-86
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00183
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290338.CKO_02652
Sequence length 150
Comment (Citrobacter koseri ATCC BAA-895)
Sequence
MIAMILVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMF
AVLTLLAAWLWWKWLARRVREQKPADSHLNQRGKQLVGHRFILETALVNGRGHMRVGDSS
WPVSADADLSAGTQVEVIAIEGITLRIRAV
Download sequence
Identical sequences A0A1F2K353 A0A1Z3XN95 A8AJU7
gi|157146877|ref|YP_001454196.1| 290338.CKO_02652 WP_012133478.1.29396 WP_012133478.1.62044 WP_012133478.1.67650 WP_012133478.1.8528 WP_012133478.1.88595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]