SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290338.CKO_04134 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290338.CKO_04134
Domain Number 1 Region: 143-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.81e-128
Family Enolase 0.000000000129
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.43e-56
Family Enolase N-terminal domain-like 0.000000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290338.CKO_04134
Sequence length 432
Comment (Citrobacter koseri ATCC BAA-895)
Sequence
MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVTKAVAAVNGPIAQAILGKDAKDQAGIDKIMIDLDGTENKSNFGANAILAVSLANAK
AAAASKGQPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTLK
EAVRMGSEVFHNLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD
ITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEDLTKQYPIVSIEDGLDESDWDG
FAYQTKVLGDKIQLVGDDLFVTNTKILKEGIDKGIVNSILIKFNQIGSLTETLAAIKMAK
DAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKA
PYNGRKEIKGQA
Download sequence
Identical sequences A0A078LNX9 A0A1F2J737 A8ANY7
WP_012134889.1.29396 WP_012134889.1.51200 WP_012134889.1.62044 WP_012134889.1.6732 WP_012134889.1.67650 WP_012134889.1.82876 WP_012134889.1.8528 WP_012134889.1.88595 290338.CKO_04134 gi|157148317|ref|YP_001455636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]